NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214923_10007816

Scaffold Ga0214923_10007816


Overview

Basic Information
Taxon OID3300023179 Open in IMG/M
Scaffold IDGa0214923_10007816 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11553
Total Scaffold Genes39 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (64.10%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006658Metagenome / Metatranscriptome367Y
F014121Metagenome / Metatranscriptome265Y
F056606Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0214923_1000781618F014121N/AMMNNTAYQIWETFKAELIVEPTDDMKEALASSIRVISSLIYRDGVLADEPWHFYIAQELNEYADEL
Ga0214923_1000781627F056606AGGAMTIRAEQIVNATLEHSLRPKRGGRAKVIAVALREVADRLCTDLGELQCPIEVLREIADEVEAL
Ga0214923_1000781638F006658GGAMSTGELIDSSKFQEELSKKNTLGETLNSPEMVKMREDFAKAHQESIDKSVGWYYNLSEEDKYKAVEALCHIICKAEREGTSHRGLQRTLGLYPQAFWIDGLMDIHNSLYTEYQDRESKEWKQDMKTLDDIIDK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.