NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214919_10027805

Scaffold Ga0214919_10027805


Overview

Basic Information
Taxon OID3300023184 Open in IMG/M
Scaffold IDGa0214919_10027805 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6007
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (80.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002245Metagenome / Metatranscriptome578Y
F004051Metagenome / Metatranscriptome455Y
F017829Metagenome / Metatranscriptome238Y
F020168Metagenome / Metatranscriptome225Y

Sequences

Protein IDFamilyRBSSequence
Ga0214919_1002780510F004051GAGGMTIEGKLYQVGDLFTTLKSKKTGVIKEIHPQASGSVRVLLEMPTRETRWTSVSAKTLLGA
Ga0214919_1002780512F002245AGGMSNLMKVPHTVEFEAVIDLDKIPANLLPALIALDTYSVTKMCKEATLHALGMSNVLPLANENNTWAEVTIKENN
Ga0214919_1002780513F020168GAGMYDILGSLIGIILICLLCSPIVLAIYMWTHAESDIDNDGKKDLPNRWDR
Ga0214919_100278058F017829AGGMANRFRVEIYDADKNNDITIYSDQGVDKEYLTELVFSNIKNFSGKINAYVFDNVKKKKTTAMFLDESTVEFNKNIIRNATKVELGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.