NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222689_1003996

Scaffold Ga0222689_1003996


Overview

Basic Information
Taxon OID3300023231 Open in IMG/M
Scaffold IDGa0222689_1003996 Open in IMG/M
Source Dataset NameSaline water microbial communities from Ace Lake, Antarctica - #1231
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2330
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Ace Lake
CoordinatesLat. (o)-68.4725Long. (o)78.188Alt. (m)Depth (m)12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016994Metagenome / Metatranscriptome243N
F022908Metagenome / Metatranscriptome212Y
F025320Metagenome / Metatranscriptome202Y

Sequences

Protein IDFamilyRBSSequence
Ga0222689_10039961F016994AGGAGGMATENNTTFVAATGSLLGKELEFITIDAGEELANHLLKNETANAIENTVRQYGNIVGAGPLFDTNASKTYIVEGTDMFVGAPASSGGSFTFTESGADGSSVGTLLAALKALGTVDGIDLNDSGTTAKIENLEL
Ga0222689_10039963F025320AGGAGMTTKVNPTKLNTTDHLSGKTITAVTVDFAVNGTDFSDTEMGPLGAVQAALATMTQEATPIIITKLRSDGSNDGQVFDMVFEGEFGTDTYDGSNSEAFAAYLQTVIRLLTSVGAGSVNLNAATVVAATAASF
Ga0222689_10039964F022908N/AMPSHLDEAIKIITSPDSQLRDETPRIYAMPKDEHMPKGFTNLKRMRYLSHDVCGGRNIKRWLWRDYSPELILQQPPFDRYEDQSEVFTLIRDPEERWWSGIKDMFYFMPWYGWWANDKIMAQWPHFGRGTLRYHDIMEQIKPQHLIKCDDGLNDRIIKFAKDNGLLCFGNIPHEKALRHTKPDIKKLEDKGVKELKAWLKENPDRQQQLDDYLEPDWQYWNRVEEQD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.