NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224547_1000098

Scaffold Ga0224547_1000098


Overview

Basic Information
Taxon OID3300023255 Open in IMG/M
Scaffold IDGa0224547_1000098 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17165
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (68.18%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3534Long. (o)19.0472Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009744Metagenome / Metatranscriptome313Y
F011009Metagenome / Metatranscriptome296Y

Sequences

Protein IDFamilyRBSSequence
Ga0224547_100009811F009744GGAGGMAIQDYVRSIAATGTVSKDQVFRFLEMQFSRADRNHDGELDADELAAFVLAVAKPEMDQR
Ga0224547_100009814F011009GGAGMNTLSTKLTAFAAALLMNSLIMGAVGYLFKIQSHPHMSAFAFARQIVAHQWFI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.