Scaffold Ga0247780_1171248

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247780_1171248

Scaffold Ga0247780_1171248

Overview

Basic Information
Taxon OID	3300023265 Open in IMG/M
Scaffold ID	Ga0247780_1171248 Open in IMG/M
Source Dataset Name	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	585
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location Name	USA: Wisconsin
Coordinates	Lat. (^o)	43.3	Long. (^o)	-89.38	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011693	Metagenome / Metatranscriptome	288	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247780_11712481	F011693	N/A	VFEDCAHWWALARHSLIALDAIHELQLVHLDLKADNVCIPVGPADFDPLARGQWLQPRFDDIALIDFAFSLVSGERLESALPIAQQADYDYQSPRLLRALAAGRHGDLVPTRQLDWRCDLFSLAAMLWRYLPELEETTTGAWTRARHAKARALVRRLVEVHDAELPARRPHAELIALAGETLAHAELGESLQRGW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.