NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209414_1000045

Scaffold Ga0209414_1000045


Overview

Basic Information
Taxon OID3300023301 Open in IMG/M
Scaffold IDGa0209414_1000045 Open in IMG/M
Source Dataset NameHypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)48987
Total Scaffold Genes69 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)56 (81.16%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Lake Vida, Antarctica

Source Dataset Sampling Location
Location NameLake Vida, Antarctica
CoordinatesLat. (o)-77.38861Long. (o)161.931111Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004788Metagenome / Metatranscriptome423Y
F053810Metagenome / Metatranscriptome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0209414_100004552F053810GGAMSLTVRPVDTNYIQQVWPIVEGFIQEALDKGGEFPDWADSYNAHHVQMFLTSGQWTLFVAVDEENKIHGAMTISYINYPLHRVAFVTTTGGKFIANPDLLEQLKALVKINGATKIQAYCRESMVRLLARANFEPRNTLVEVLV
Ga0209414_10000456F004788AGGMDVFEVLIQQANERIDQLKEFLAEGRADSYEEYKKLCGEIRGLLTMRGYTLDLKNKMENSDD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.