Basic Information | |
---|---|
Taxon OID | 3300023301 Open in IMG/M |
Scaffold ID | Ga0209414_1050640 Open in IMG/M |
Source Dataset Name | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1147 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Lake Vida, Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Vida, Antarctica | |||||||
Coordinates | Lat. (o) | -77.38861 | Long. (o) | 161.931111 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029953 | Metagenome | 186 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209414_10506401 | F029953 | N/A | GMPQKVLERDLTELLRKYDRECAVLTANRLNRLRGGSVPTPDESRALLEWSENSIESFRDGD |
⦗Top⦘ |