NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256753_1135739

Scaffold Ga0256753_1135739


Overview

Basic Information
Taxon OID3300023368 Open in IMG/M
Scaffold IDGa0256753_1135739 Open in IMG/M
Source Dataset NameHydrothermal Fe-rich mat microbial community from Snakepit Site, Mid-Atlantic Ridge, Atlantic Ocean - 667-BS4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Delaware
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)775
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Source Dataset Sampling Location
Location NameInternational: Snakepit Site, Mid-Atlantic Ridge
CoordinatesLat. (o)23.369112Long. (o)-44.950984Alt. (m)Depth (m)3504.92
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082711Metagenome / Metatranscriptome113N

Sequences

Protein IDFamilyRBSSequence
Ga0256753_11357392F082711AGAAGMRTTEFKIKLDGRTFRGQLPCSVSKKRPELGPLIDSEDLEVFEGKVARRIFAEKLRGSQSFRLCRSYCEMSMQAVADLLQVDRRTVQRWESEESPVPPWAMLLVSKMADERSKGRAVMRSWLVAL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.