NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257053_107212

Scaffold Ga0257053_107212


Overview

Basic Information
Taxon OID3300023490 Open in IMG/M
Scaffold IDGa0257053_107212 Open in IMG/M
Source Dataset NameHuman gut microbial communities from healthy child feces in Northridge, California, USA - CDI_70C
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, Irvine
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2694
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome

Source Dataset Sampling Location
Location NameUSA: Northridge, California
CoordinatesLat. (o)34.2381Long. (o)-118.5301Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F072366Metagenome121N

Sequences

Protein IDFamilyRBSSequence
Ga0257053_1072122F072366AGGMLDILAIKADVYQLERQGKRLPVYRYLREVWQKELPSEGLTVLALQQMVDYVEYVDDLTVLGEPWEVENEYDLYQDFLLDVISWGLQKYRAKKRLLWQICYYVNAWATFYYIFGREITQDNVEQWKKTLFEEAKERYPDSLLFEFIPHAAQLDYVWFYRLTDEQRLQIRLEVGEWNLQKNDMDQAVQSYFDDAMTWYRDNGRKLLEAKKQGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.