Scaffold Ga0257057_103614

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0257057_103614

Scaffold Ga0257057_103614

Overview

Basic Information
Taxon OID	3300023494 Open in IMG/M
Scaffold ID	Ga0257057_103614 Open in IMG/M
Source Dataset Name	Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_85A
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Irvine
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5197
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome

Source Dataset Sampling Location
Location Name	USA: Northridge, California
Coordinates	Lat. (^o)	34.2381	Long. (^o)	-118.5301	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097493	Metagenome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257057_1036143	F097493	AGGGGG	MYKFYMKNGTAYFYEHGVEIDGTVYGIHTDRDILRIKRSVVNNKFAETDDNFDMDTEIAKIKHTDITFEQPTAEQLSQIQSKTFDSMSDMKQYVQSVMNGDETMSQDEINAMLLLKIAEMEVAITNEQTTN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.