Scaffold Ga0257052_103035

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0257052_103035

Scaffold Ga0257052_103035

Overview

Basic Information
Taxon OID	3300023499 Open in IMG/M
Scaffold ID	Ga0257052_103035 Open in IMG/M
Source Dataset Name	Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_69C
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Irvine
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7709
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (72.73%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome

Source Dataset Sampling Location
Location Name	USA: Northridge, California
Coordinates	Lat. (^o)	34.2381	Long. (^o)	-118.5301	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090515	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0257052_1030355	F090515	GGAG	VRTCCKASPKAALQGTAPGRVACLEFAEGEKRKTNIAADYAVKALAFTALLCRHIGSIRTFLKS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.