NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257021_1085128

Scaffold Ga0257021_1085128


Overview

Basic Information
Taxon OID3300023500 Open in IMG/M
Scaffold IDGa0257021_1085128 Open in IMG/M
Source Dataset NameMarine microbial mat from Loihi Seamount, Hawaii, USA - Marker 39_BS4 Individual Assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterWestern Washington University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)742
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mats From Loihi Seamount, Hawaii, Usa

Source Dataset Sampling Location
Location NameLoihi Seamount, Hawaii, USA
CoordinatesLat. (o)18.902Long. (o)-155.257Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099441Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0257021_10851281F099441N/AMMLTDLGIKGESKTPSGINVHLIESDDISYIWDDILPLIRVSLRYAEGELEPEDLVIHLDTGQMNLWVAMEKNEVIASMITEIITYPRKRILRVITLASKDGHGMDNWYDFLPMVEGFAINNGCSALEAWTRKGLARKLKDWKHSYS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.