NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256727_1020686

Scaffold Ga0256727_1020686


Overview

Basic Information
Taxon OID3300023548 Open in IMG/M
Scaffold IDGa0256727_1020686 Open in IMG/M
Source Dataset NameHydrothermal Fe-rich mat microbial community from Loihi Seamount, Hawaii, USA - 677-SSYellow
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Delaware
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2091
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat → Hydrothermal Fe-Rich Mat Reference Genomes

Source Dataset Sampling Location
Location NameUSA: Loihi Seamount, Hawaii
CoordinatesLat. (o)18.905558Long. (o)-155.256977Alt. (m)Depth (m)1271.23
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061392Metagenome / Metatranscriptome132N

Sequences

Protein IDFamilyRBSSequence
Ga0256727_10206862F061392AGGMIVKRLSIFCAVFIVGLFITLQTIASGLDEPDPTFKLAATLFPIDGGQLFIGNVDRDKKTFRLHLRHIGKNSKWIYYYASASTFVNEDGEVEPDNAVASIEYPQYTASIVGNTFRKARVRILFIPRGEGKGFFKEAGHVIFQKCATKAFEAKDWKCTGWEYLGKLPGFP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.