Basic Information | |
---|---|
Taxon OID | 3300024228 Open in IMG/M |
Scaffold ID | Ga0228633_1150117 Open in IMG/M |
Source Dataset Name | Seawater microbial communities from Monterey Bay, California, United States - 41D |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 517 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 36.8313 | Long. (o) | -121.9047 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021115 | Metagenome / Metatranscriptome | 220 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0228633_11501171 | F021115 | AGGAG | MSNHETNIELDNPLSSAKIGAYSGSIKARFYKSGKVFKGIPAVDIHSELRSVLCNSKVKIQPYNVTYKDGQLQIDLPNNIKGSLANLIIVKTLTTVGLRYKCVSCKLELYNITKTICFHY |
⦗Top⦘ |