NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0233402_1053263

Scaffold Ga0233402_1053263


Overview

Basic Information
Taxon OID3300024229 Open in IMG/M
Scaffold IDGa0233402_1053263 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 54D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)858
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021182Metagenome / Metatranscriptome220Y

Sequences

Protein IDFamilyRBSSequence
Ga0233402_10532631F021182N/AMNKYENGYMGKIEYWTEKLNAEVFQTQKPDLVEIDSIHKKLDYFIQKQTD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.