Scaffold Ga0209978_10397372

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209978_10397372

Scaffold Ga0209978_10397372

Overview

Basic Information
Taxon OID	3300024263 Open in IMG/M
Scaffold ID	Ga0209978_10397372 Open in IMG/M
Source Dataset Name	Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	673
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location Name	South Atlantic Ocean
Coordinates	Lat. (^o)	-27.74	Long. (^o)	14.251	Alt. (m)		Depth (m)	1133
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023034	Metagenome / Metatranscriptome	211	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209978_103973721	F023034	N/A	MNVNIYNTKDYENKHNWTFGQSKPNSNPIKPNLKKAKMNVNLTLTKDYRKKDDFVVRINKPNFRNGQNER

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.