NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257091_11849497

Scaffold Ga0257091_11849497


Overview

Basic Information
Taxon OID3300024270 Open in IMG/M
Scaffold IDGa0257091_11849497 Open in IMG/M
Source Dataset NameGoat fecal pellet fungal communities from Santa Barbara, California, USA ? pellet 1 Spades (v3)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)587
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.4204Long. (o)-119.6671Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059516Metagenome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0257091_118494971F059516N/AMQSLEVIGVGYLGIFVMTGVIIAVVSLLNKFTSGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.