NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247687_1006724

Scaffold Ga0247687_1006724


Overview

Basic Information
Taxon OID3300024286 Open in IMG/M
Scaffold IDGa0247687_1006724 Open in IMG/M
Source Dataset NameSoil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1481
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)40.4449Long. (o)-87.0297Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011170Metagenome / Metatranscriptome294Y
F032575Metagenome179Y

Sequences

Protein IDFamilyRBSSequence
Ga0247687_10067241F011170GGGGGVRENDVVFIKLPDEPATVIVTVPMAAVLLAVSVKVLVFAVLLGLKDAVTPLGRPDADRLTLPLKPPCGVTVMALVPLAPCTTVKLLGDIEREKPGGG
Ga0247687_10067243F032575N/AALPASPTEPTSWSNQETGSGCEVTVKRTALLSFIVGATETSKGPEVAPGGIVMVMDVSLQVLIVTAAPFSRTALPPCVAPNPEPEITTWLPMEPVVAETAVITGAGAAAELTETLSKVAVANEAVLRLLTAKPTYTFCAMFTVWLDPNWTQFTPSAEPYRVNTFPLLASFIQYGSVRLPN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.