NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255147_1000535

Scaffold Ga0255147_1000535


Overview

Basic Information
Taxon OID3300024289 Open in IMG/M
Scaffold IDGa0255147_1000535 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10536
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001841Metagenome / Metatranscriptome627Y
F009141Metagenome / Metatranscriptome322Y
F021513Metagenome / Metatranscriptome218Y

Sequences

Protein IDFamilyRBSSequence
Ga0255147_100053511F009141N/AMTENSMVPFYRSYLLNGRTIYLDKLSELSDSELHLLNVDTMAALQEARHEYDNIENKQSEEARPAYRRLKVAGYFQAAIKLELQD
Ga0255147_100053516F001841N/AMFNPPNFFLGLMRVVAWAFWRDPVAKPEPPQPKRPRKPILGYTVGDIPFELMAVVRVSWYRKGMAYEVEEYKIEESEDAQDQFHYVVGTALKQGADVCVLTQYQPEELGVPT
Ga0255147_10005358F021513N/AMNMYILSEAQFDQVIKALDAARFALDTCQHVELDLTNPKQTIPLPAGEKIVRTTAVRQSQSKTRKSSRKGQRGVAVLTEPKVLEIKRQLAAGGKSVAKIAKEFAVHPTTINCIKSGKTWRHVAIQQETVAAAAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.