NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228624_1003431

Scaffold Ga0228624_1003431


Overview

Basic Information
Taxon OID3300024313 Open in IMG/M
Scaffold IDGa0228624_1003431 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 29D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5212
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (10.53%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015096Metagenome / Metatranscriptome257Y

Sequences

Protein IDFamilyRBSSequence
Ga0228624_10034314F015096GAGVHLYINHKDEDNMNTLTQWQARRKELEDKYVELMLAKYPLLTDVTTNIQRENGTRTFQLNHKKYGLCKFATYKSGMVRKIIRTRFKDLSCYQLNPQRSITNYYMTLGDNSELNMSSYVGKQRVKITNGLARLVYLEKYLIKNYDLDSVQDVIEVDGVLYKRI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.