NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0244777_10005689

Scaffold Ga0244777_10005689


Overview

Basic Information
Taxon OID3300024343 Open in IMG/M
Scaffold IDGa0244777_10005689 Open in IMG/M
Source Dataset NameCombined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8082
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (73.68%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.234Long. (o)-123.9135Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031657Metagenome / Metatranscriptome182Y
F037425Metagenome / Metatranscriptome168Y
F039346Metagenome / Metatranscriptome164Y
F044731Metagenome / Metatranscriptome154Y

Sequences

Protein IDFamilyRBSSequence
Ga0244777_1000568916F031657N/AMKKQKKMHFLYHIENVGFKMLTESQARKYKDKHGDVIWNVHKTLDLSPDFLEVK
Ga0244777_100056896F039346AGGAMIATFVITLIECLEIAFITLLLVQTNIRKRDSEKHLRQHLQVLPQVQIIMYGILGLIGGLLTAYYLHDMLENYEWLMYAILSGLFFYLFYRNKDIQKHIKEHVDNIRQSSSTVLFLAAFFIYGRESFEIFSNLFLNPNASWSAAICAAIVAFMIYMFARDSKYTSYVFKFGYWAYLAFGIWFGYEALEHLHIL
Ga0244777_100056898F044731GAGMTLEEVYRKYEKLTLEICTGETSHDNTLECAGAMMGQAMKLYKLCLSPEDFDALMQIISQASGLDGDGWDDDDFPSGTLH
Ga0244777_100056899F037425GGAMKTSTVKPLYKWNGFRKQYMGIIQNLINNVDICNRRFAEEGEEGYLIQREVYIKEIEELKTFIKQKEIELGYYGDEHEDKTS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.