NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209992_10028190

Scaffold Ga0209992_10028190


Overview

Basic Information
Taxon OID3300024344 Open in IMG/M
Scaffold IDGa0209992_10028190 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2900
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameKolumbo volcano, Aegean Sea
CoordinatesLat. (o)36.5264Long. (o)25.4868Alt. (m)Depth (m)470
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049037Metagenome / Metatranscriptome147N
F060975Metagenome / Metatranscriptome132N
F097503Metagenome / Metatranscriptome104N

Sequences

Protein IDFamilyRBSSequence
Ga0209992_100281904F049037GAGMTESPCDTCHNYWLCMEGSRACSDFKLFYDTGKITHHDRSPNWYIDMPPHTITVRELSERCGFGKETNKLKHWLGLRTFPLIEDPLGFYFIRHIDGAIENTYTGKSSKRLRNAQAACREVVLEAKVRESTARTQNNVGRVVQREMGRNLARVCEQEDPGES
Ga0209992_100281905F060975AGGAGMGKTIRRNPVARNSEKFNKPKTIRDRKKDFYRPDSKRDLEEAIEDMSFDEHNRKDAIIIQYQDDLARSQEDGWPYED
Ga0209992_100281906F097503AGGAGLAIRGLDMDCDTFDGIVEIFEQRIMEGCIANEFKCTYNEEKGEFIAEIDGKYYVAMTREK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.