NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209992_10077038

Scaffold Ga0209992_10077038


Overview

Basic Information
Taxon OID3300024344 Open in IMG/M
Scaffold IDGa0209992_10077038 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1529
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → environmental samples → uncultured virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameKolumbo volcano, Aegean Sea
CoordinatesLat. (o)36.5264Long. (o)25.4868Alt. (m)Depth (m)470
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035122Metagenome / Metatranscriptome173N
F078599Metagenome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0209992_100770381F035122N/AMTKTEKNFDKNFKYIEVKKTKTMIEEIQSNETETFLNSLKANEPLKKVLFLAKNVSKKLMVDIVPKMSKSVNALMIEINSGKNTSLKDWNTIKFLRQHLYNLSSYDRTKDVNSAFEMAVTRSIKLAIMMYDNKDQFEVSEKNEVFIMSKVATPMIDVKLKGQKSGTKKVKNDSTDLVEVNTGTIDKVWNIKYPNAVTTRSSQTKDTKINFSQMVTNFMRELEKVYNVANKKDHNKLLELLDEKAIENLGNIKAMLESNEIRQEYIKATENLSVDGDVKKIA
Ga0209992_100770383F078599N/AMKVYMESNIFYILLYGGISLIVIGAILYGVSYFMVKYYESQINKHTFEI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.