NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0244775_10105616

Scaffold Ga0244775_10105616


Overview

Basic Information
Taxon OID3300024346 Open in IMG/M
Scaffold IDGa0244775_10105616 Open in IMG/M
Source Dataset NameWhole water sample coassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2391
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameUSA: Columbia River Estuary
CoordinatesLat. (o)46.234Long. (o)-123.9135Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001562Metagenome / Metatranscriptome670Y
F003690Metagenome / Metatranscriptome473Y
F019325Metagenome / Metatranscriptome230Y

Sequences

Protein IDFamilyRBSSequence
Ga0244775_101056162F001562AGGMKSQLEKDLEIKESFIDLLNDVYPDVKIGYSTFTAAEILECCDPIAFAIGLVEHEDYLAEMENEXATYLDLKKQFN
Ga0244775_101056166F003690GGAMTINGFELYITSDYGLEFDSFLGAIYLPWHTIAITTALLIAYKVYKRKKNK
Ga0244775_101056168F019325AGGAGMTQLTEELYSTIVHDFHNGGVKSSYGLNAYTRKALLRDLLSSKACYCIECVCEATHTAQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.