NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0244775_10489816

Scaffold Ga0244775_10489816


Overview

Basic Information
Taxon OID3300024346 Open in IMG/M
Scaffold IDGa0244775_10489816 Open in IMG/M
Source Dataset NameWhole water sample coassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1005
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameUSA: Columbia River Estuary
CoordinatesLat. (o)46.234Long. (o)-123.9135Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039946Metagenome / Metatranscriptome162N
F055731Metagenome / Metatranscriptome138N

Sequences

Protein IDFamilyRBSSequence
Ga0244775_104898162F039946N/AMGLLGKILLNESVTIFKCDILIKTDAIENKVEIYNEIRALSGVVVVTIEQSDFLNTKATKAYEYSLLKLKYIGRGDAKTSIKEIGIDAVTKNRISGLLQFIPRYNTIIKVGSY
Ga0244775_104898163F055731N/AMIKLIDLLELEKPTNIYAPGEEPGDAPEKDLMQKGFKLSKAEIDPETGASVTNVTYLPAFETIRRQTIRMRKEFQPFGFSSNEDIAKVAKGINTNLTKVSQMIYALEKMIELQNKSK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.