NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0179591_1107944

Scaffold Ga0179591_1107944


Overview

Basic Information
Taxon OID3300024347 Open in IMG/M
Scaffold IDGa0179591_1107944 Open in IMG/M
Source Dataset NameVadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2202
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000909Metagenome / Metatranscriptome841Y
F006202Metagenome / Metatranscriptome379Y
F072175Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0179591_11079441F006202GGAGVQFLGPDGDTVLYCYVHDLYDGQQMRPEKLAAWRALRERYGNRDESRVDRGTLLAPAA
Ga0179591_11079442F000909AGGAGMSMIAGISEPASELERLIGELSESGQLVFVFGVGWWTAHLAGATTPVFRGPADRRWWHVVLGDDAASWTMDVRVDEITGVRFVREPYPFPLLPGGSL
Ga0179591_11079444F072175N/ANFVTMGQVGLTRWTGEVAQPVARSIARRTGQPEARR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.