NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0196962_10003619

Scaffold Ga0196962_10003619


Overview

Basic Information
Taxon OID3300024430 Open in IMG/M
Scaffold IDGa0196962_10003619 Open in IMG/M
Source Dataset NameSoil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4880
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.305Long. (o)-116.2547Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001264Metagenome / Metatranscriptome735Y
F009555Metagenome / Metatranscriptome316Y
F044333Metagenome / Metatranscriptome154Y

Sequences

Protein IDFamilyRBSSequence
Ga0196962_100036191F044333AGGAGGMMDRERPSASDSKEMIPEAWIGQEVMIETTEILSSDLRASAPVYLEDVNDRGIVMLVT
Ga0196962_100036192F001264AGGAGMRAEQTVSEMAQVVLWRQARVLAQRTGEPLVEALEAVVETPAGLQLEELRCGAHQDEEARYWQANLLLERVSEQAEHPV
Ga0196962_100036193F009555AGGMVQILERLQAHYESREMPFATVYNTFEWHPASVALECDCGDKVTLNATSTITSTCSGCGADLGTFVNEIREREGRLPDKLTHPWFYDARERAQQHEHDEAAYLEGSPWRYEDITAASNEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.