NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209986_10013010

Scaffold Ga0209986_10013010


Overview

Basic Information
Taxon OID3300024433 Open in IMG/M
Scaffold IDGa0209986_10013010 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6087
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (78.57%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameAtlantic Ocean: Black Sea
CoordinatesLat. (o)44.288Long. (o)34.983Alt. (m)Depth (m)2075
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016666Metagenome / Metatranscriptome245Y
F025768Metagenome / Metatranscriptome200Y
F087273Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
Ga0209986_1001301010F016666GGAGGMNNPFKRTGKQPKLGVKSYSVEDVKAADKRFYDKFPGAVEDAAMLKKAMQNPGDEVVKIDDERKAQHASMMKAMKIEVEIS
Ga0209986_100130103F025768AGAAGMLNLFKKLLGIDKLEYKIRLLERKNYWREKYNVRQNNL
Ga0209986_100130107F087273N/AMAKKTREQVTKEILDVDFENIGTAREFDDDGYEEGKSKEREMTANASVSDSYKGGLLYKGKAKNYTSAADLIKKKEAKIIKLNPSKKTNKD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.