NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255059_10008346

Scaffold Ga0255059_10008346


Overview

Basic Information
Taxon OID3300024486 Open in IMG/M
Scaffold IDGa0255059_10008346 Open in IMG/M
Source Dataset NameMetatranscriptome of sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1766 RNA GHGlow gp2 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3514
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameNew Zealand: Palmerston North, Manawatu-Wanganui
CoordinatesLat. (o)-40.3794Long. (o)175.6106Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065312Metagenome / Metatranscriptome127Y
F086398Metagenome / Metatranscriptome110Y
F087968Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0255059_100083461F087968AGGAMVKITKGMARKLYNEGEEVMIIPNRVRPDGMLASWTTKPADDPTADFDKLCNAIFYYNCSPETGMSLVYYAKAI
Ga0255059_100083463F086398AGGAGMEMTYHVAVQRANRVQHIVEEIGIGQVVREQYRGRGLGQAGCYVCITDTGITIIKSEDKLKVITMYVTTQRELVAVYGGPKKVPNFLRKKVDHNQSKYTQGGKTIWR
Ga0255059_100083465F065312AGGAGMSKKKKQPKTWVEVFQSERKEFPQGYCVTRVIPDKRNKKPKHKGKELE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.