NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255185_1028880

Scaffold Ga0255185_1028880


Overview

Basic Information
Taxon OID3300024490 Open in IMG/M
Scaffold IDGa0255185_1028880 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)783
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C493(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Louisiana
CoordinatesLat. (o)29.8571Long. (o)-89.9778Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016388Metagenome / Metatranscriptome247N
F065780Metagenome / Metatranscriptome127Y
F102851Metagenome / Metatranscriptome101N

Sequences

Protein IDFamilyRBSSequence
Ga0255185_10288802F016388AGGAMNSAIAKALDLGQRLVSLFIASALPIITGGAILGVDVIKSAGVAGLTALFGVVQKLAAASVDGELTSEEIAEAFGSAKKKAGK
Ga0255185_10288803F065780GAGMKQIIAYIRDNTWTWVGTGMVLITLSGPTLRQALFLTGIGIVLHSLISLTQKDPE
Ga0255185_10288804F102851N/AEQLFEQLQVDELTEEQLAEFTAAIQEAPTKVKKAFEKTINIFGSEFENYVPTGSNIPVKTRRTLVAAGALIAAIPSTRVRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.