NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255181_1004531

Scaffold Ga0255181_1004531


Overview

Basic Information
Taxon OID3300024502 Open in IMG/M
Scaffold IDGa0255181_1004531 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3345
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027496Metagenome / Metatranscriptome194N
F031464Metagenome / Metatranscriptome182N
F039106Metagenome / Metatranscriptome164N

Sequences

Protein IDFamilyRBSSequence
Ga0255181_10045312F031464AGGMRKLIQPRKRKVNPYVAYLENHGRHATLEDLLEAFPNKTSKQIRDSMSKLVDNYTVDRDIRKDDHQYLISYSLGGYNTRDNTGICWHNPFNLRTI
Ga0255181_10045315F027496GAGGMTKEMLDELLYLIELQIKANLALALGHADAADKEAEREHVQYYRLVSLIDSMKDDLK
Ga0255181_10045316F039106AGGAMIQLYFNGKPCEIVSRDSADGTVCIRYAADHPNWPFPNYTWVDPRVLSKLRQSKHAKRLEALQGIDDALM
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.