NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255280_1001095

Scaffold Ga0255280_1001095


Overview

Basic Information
Taxon OID3300024555 Open in IMG/M
Scaffold IDGa0255280_1001095 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4500
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (16.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022861Metagenome / Metatranscriptome212Y
F028489Metagenome / Metatranscriptome191Y
F042298Metagenome / Metatranscriptome158Y

Sequences

Protein IDFamilyRBSSequence
Ga0255280_100109510F042298N/AMNENDGIPEDMTLADMLKMRDLNIYHWQEYERAKERARLQSNKQENLGETTKDSEREPNRGEEIY
Ga0255280_10010953F028489N/AMIMNMIGKELKVNTTTDYSKFAVLPMNRGIDSKHVQKMIASIRKMGVLRCVITTTTDIIEGEKKRYIIDGQHLATALEREEMPIPFIDITVDSEEDLIEKMAYLNNSSKSWDLMNYINSWKMIRPDYMKLFKWKNMYDIEITMLAAIGVNNAGIRTSTQSIKTGSFKITNPNAEDMCKAFNDIFLKIGMSERSVKFQFLTAFLQAYGNYNHEKVITNLDKHLKTVKLMMNGEETATYIRRKIFNLPK
Ga0255280_10010957F022861AGTAGMKAICIDASNKPNKIPDNEWVKEGEVYTITRVVRMGLQDNKFGVLLKEVKLSAESFPYELYDADRFLPIDLLSQALEETKETVKEADLELI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.