NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256337_1116481

Scaffold Ga0256337_1116481


Overview

Basic Information
Taxon OID3300024573 Open in IMG/M
Scaffold IDGa0256337_1116481 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)666
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004694Metagenome / Metatranscriptome427Y
F105018Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0256337_11164811F105018N/AMNASVISSIVRHLLGIAGGWLLAKGISLDAGTIETIAGSVGSLLAVGWSLYAKRGSASPS
Ga0256337_11164813F004694N/AEIAIQPVSVWTATGTKTAVKFFPRYINYQNGPAVADCVLLDAAGAEVSCQLVNATEAQTDAWTIDEAFYKVLAQNAGLSPV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.