NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256312_1069171

Scaffold Ga0256312_1069171


Overview

Basic Information
Taxon OID3300024861 Open in IMG/M
Scaffold IDGa0256312_1069171 Open in IMG/M
Source Dataset NameMetatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8h (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)754
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae → Guillardia → Guillardia theta → Guillardia theta CCMP2712(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: New York
CoordinatesLat. (o)45.0061Long. (o)-74.7949Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019660Metagenome / Metatranscriptome228N

Sequences

Protein IDFamilyRBSSequence
Ga0256312_10691711F019660GGAVCGAQQFEIPTSFEGFSALVVKWLSPVEQLSPFKVGQIQKLIAQIAESAGNKELGNQIAPYFAVAQVIFLLLFVAYFVIGVVALAVDAEAMDAECAADSWIWLYALLVIVIPTSLGFVLSLVEAGLKMIPQLEGVKYDVFLILPPPILMVVLGILGIVLWGGMTDECDDFYGANHGLLLGVFHIQVLIMCIASVFGTITLIGFCADLFNDLASKVGYD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.