NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208018_108202

Scaffold Ga0208018_108202


Overview

Basic Information
Taxon OID3300025057 Open in IMG/M
Scaffold IDGa0208018_108202 Open in IMG/M
Source Dataset NameMarine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1543
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NameGulf of Mexico
CoordinatesLat. (o)28.867Long. (o)-90.467Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001018Metagenome / Metatranscriptome804Y
F002738Metagenome / Metatranscriptome533Y
F013517Metagenome / Metatranscriptome270Y

Sequences

Protein IDFamilyRBSSequence
Ga0208018_1082022F002738N/AMTIDTYGLTSDQYKEFFDKNIRLAAQLYLKAQNIIFSTGVSNADFKTILDLYSETVYATNDDCRRYQKSNNPEALKEATVEIFGITPTREELMAEIQSVNAKVEALTDYVAKLVETQQG
Ga0208018_1082023F013517N/AMFETLLATVLPMMKDLLWAAAGMLLTYTLNKIQSQFN
Ga0208018_1082025F001018N/AMTQITQAKLKELNVLQLYEHYGALERSLPLLTPESQELAKAELETCADLRSEKIDRIYYAMAAHEDAIERIKKEADLITQARRHHESQLKSLKGLLNWLRRSLPFDTSKITGRNYQFTLVKKKDLTVEISSDPEFWHTQERAAYCVEEEVTTTKQVVLRSMSGEILYERIEPKTITKVLPNLDAIRSAYQEG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.