NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208667_1003158

Scaffold Ga0208667_1003158


Overview

Basic Information
Taxon OID3300025070 Open in IMG/M
Scaffold IDGa0208667_1003158 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5104
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (45.45%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-14.21Long. (o)-77.52Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001166Metagenome / Metatranscriptome760Y
F006585Metagenome / Metatranscriptome369Y
F037741Metagenome / Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
Ga0208667_10031582F001166N/AMATEVGENVQVKANLAFMAKVIAIVGTCVWGYSVIWNKINELDNGLGRVQHEGTLLGDLSARMMHLEKFAEQAKADLDHLVEMQDAPITSDYQQFERLKYIEKELDRLRDRVEK
Ga0208667_10031583F006585GGAGMALPKLDRKDFIITVKTGTDTNKSEFKKQAIQGELYFATDTKKIYVAETTAGASDATIAEFAPTSTGN
Ga0208667_10031586F037741N/AMPYFGLGLHIGDTESDSQVGPTPPGGPDGVIQTEAQDFLQVEAGQFLAFD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.