NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208298_1000028

Scaffold Ga0208298_1000028


Overview

Basic Information
Taxon OID3300025084 Open in IMG/M
Scaffold IDGa0208298_1000028 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)58795
Total Scaffold Genes77 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (16.88%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-14.51Long. (o)-76.2Alt. (m)Depth (m)9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017160Metagenome / Metatranscriptome242Y
F062773Metagenome / Metatranscriptome130Y
F077324Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0208298_100002846F077324N/AMYKVVTMDEFGLNVTQQDGFKTPEEAQQEAKECIERWGEMFGQDFWVEPYEQEPYKEPKQYAYPNSVDGWEDIYPTRD
Ga0208298_100002856F017160N/AMEYGNMNDYTIKGGRLINNAPECEMGITKAARMRKQMKRADKVRMIAEGNELSKANINLFKKL
Ga0208298_100002863F062773AGCAGMGTAIGNGNGIPFQDKRNDDIPELCFIVTELDEFCVQEINTTNNGRMLPETCP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.