NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208157_1007854

Scaffold Ga0208157_1007854


Overview

Basic Information
Taxon OID3300025086 Open in IMG/M
Scaffold IDGa0208157_1007854 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3680
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (22.22%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-12.999Long. (o)-80.801Alt. (m)Depth (m)90
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024111Metagenome / Metatranscriptome207Y
F025731Metagenome / Metatranscriptome200Y
F055727Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0208157_10078545F024111N/AMPQPIYAFVFPFEGGGEFRCKRNFPDAESAANWAVDIILKEGDDFCYFKEVASSDYVFEPACESHTVVRWLDDEDAPTIGQYEMYDIID
Ga0208157_10078546F025731N/AMLHSTTQRKKAQMASALFNDVQFLSFEAVRNTAEWDAMSCDEQMRLEDLIGSAQ
Ga0208157_10078548F055727N/AMYNHFIEFSVSEMVDAYVYFTHIGDYEGCRLVAEAFDSNTSIDFKGFFND
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.