NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208013_1050597

Scaffold Ga0208013_1050597


Overview

Basic Information
Taxon OID3300025103 Open in IMG/M
Scaffold IDGa0208013_1050597 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1129
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-14.51Long. (o)-76.2Alt. (m)Depth (m)45
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004879Metagenome / Metatranscriptome420Y
F039829Metagenome / Metatranscriptome163Y

Sequences

Protein IDFamilyRBSSequence
Ga0208013_10505971F039829AGAAGMSLKVRDVIRELKKFPDNYKVSLETYNEDKGNDGGWEKHNCISVDKDADAE
Ga0208013_10505972F004879GGAGMAKANELKLYQREHFQKKIETKLEPEIEREELKIKTTVNKILDKGIKSFSKSIGADKVIARLEKAEDEKREASRLAYTFFNNKASSIVSYSKAKDYKFDRDDKNTISVKDCINQLEKWAEKQAEQYAETTEQGKRLAYLKALQTKAKDMVAEASVSDDLKSSLDNLFAFVGVTWEQKLPSLPKPKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.