NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208553_1063097

Scaffold Ga0208553_1063097


Overview

Basic Information
Taxon OID3300025109 Open in IMG/M
Scaffold IDGa0208553_1063097 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)899
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-11.499Long. (o)-81.405Alt. (m)Depth (m)210
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008755Metagenome / Metatranscriptome328Y
F009404Metagenome / Metatranscriptome318Y

Sequences

Protein IDFamilyRBSSequence
Ga0208553_10630971F009404N/ACACFVQIEILIKKRLRGNIIMSSDEPEHIQPKGESLVKHCPICGVEFDEIVLTNRWLKCDSCETVFQVKVKTGE
Ga0208553_10630972F008755GGAGMNKSRVSRDLWRKVFNDNLINLSDGDARKQVVRDFLNDPVNKKAGWKAKDARFFRLGFQKVAKENNFNVMNIGVTPTPSRSKTNKGSMNINVKSKQKNPPPMGEQLKKPEEVKGLGALPTTPQLEQQQAQAVQYSAQSVGQIFETIFNIFSSRTGCSPLSQNERIALGEAWSPIFNEYFSGHSLWVMPVVISAPIMLSRLAEIQKIKKEKEVKERYGMDEVPK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.