NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209535_1010920

Scaffold Ga0209535_1010920


Overview

Basic Information
Taxon OID3300025120 Open in IMG/M
Scaffold IDGa0209535_1010920 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-28 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5110
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (90.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)48.9699Long. (o)-130.6666Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000724Metagenome / Metatranscriptome919Y
F000896Metagenome / Metatranscriptome845Y
F004907Metagenome / Metatranscriptome419Y

Sequences

Protein IDFamilyRBSSequence
Ga0209535_10109201F000896AGGAGMTNKINLVINLSILALLIYLSVAVKQIQDKVFPDPHIMQPAIGYGESLGLRSNLHKLLNNVLED
Ga0209535_101092010F004907N/AVETRHELSCANEELWSLNDWPEGEGFGSSDRFEYVRRITETVASERKFLQVEDELVQINKLDECPTNDTVRKYMIMNEEIRQGLTQGGK
Ga0209535_10109207F000724AGGAGGMPNKKENTWTIGNKGPTGPWVWHAWIKGSKKPVRVVAFDMDHIRCQLEGKQVIKAKRLPEEKDEFSSMPLGPKGSTINRPADYDQGFRILREWIDQNAGPPEEIRVKLRELYIDYDKAKQKTTRYSARKKKRHKI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.