NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209645_1018000

Scaffold Ga0209645_1018000


Overview

Basic Information
Taxon OID3300025151 Open in IMG/M
Scaffold IDGa0209645_1018000 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2725
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)18.92Long. (o)-104.89Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000379Metagenome / Metatranscriptome1211Y
F005266Metagenome / Metatranscriptome406Y
F015349Metagenome / Metatranscriptome255Y

Sequences

Protein IDFamilyRBSSequence
Ga0209645_10180003F005266AGGCGGMAVHIRYRFLKEKGDYLKDENMTRGYTMVETDIVHPYYQVLKEFYKDFKGRGVQIFNIWRTPAGQANYKFEEEERRNSV
Ga0209645_10180006F000379AGGAGMQKIDYKNKHGIMVGYIDRSDNVVAVETSWKIKPEDMAKILLEKYPTKEDAIKAVDSPALVPSFRKDDYWYVDGFGDVIESNISWHKEVMRKNVGHLFLFMKGTWQYSDNGIDWEPATELLKEVA
Ga0209645_10180007F015349N/AEEHHASSKSCENEYYVFGQYFNKGGWHTPDIIKTGPDGIEMDKLKIRYTNADGFKVFNEIEYDGEVYYLEEDSTGKSSSFYVNCGDKLD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.