NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209645_1117353

Scaffold Ga0209645_1117353


Overview

Basic Information
Taxon OID3300025151 Open in IMG/M
Scaffold IDGa0209645_1117353 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)847
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)18.92Long. (o)-104.89Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002858Metagenome / Metatranscriptome525Y
F023856Metagenome / Metatranscriptome208Y
F024320Metagenome / Metatranscriptome206Y

Sequences

Protein IDFamilyRBSSequence
Ga0209645_11173532F024320AGGGGGMTFEEYEQGYYEGDSEDNSGPPEDPETHAMVEHLVEFETEMYRLDCRRRLKGLSYRHLETMLVELHGREWKDAL
Ga0209645_11173533F023856GGAGGMRCKACDRILEESELTKKDAHGNFLDLCGICLSATASAGIDTETMQYYQYEIFTEDKDYDTLF
Ga0209645_11173534F002858AGGAGMLIDEKSIYEVTGGDYSVYCLGYTQARAVTNDIMKRDPWGGIPFVIKKDLELSLDNRGNVVMTKSTLDKILDLASDELPEGEQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.