NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209642_10133592

Scaffold Ga0209642_10133592


Overview

Basic Information
Taxon OID3300025167 Open in IMG/M
Scaffold IDGa0209642_10133592 Open in IMG/M
Source Dataset NameSoil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1437
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, Colorado, United States
CoordinatesLat. (o)39.53Long. (o)-107.78Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021061Metagenome / Metatranscriptome220Y
F086972Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
Ga0209642_101335923F086972GAGGMDAFFVGLLMGVAFGMLVVGFLAVGSYQRGFSQALERRKEWRGELVARQVVARRALEQLRKAS
Ga0209642_101335924F021061N/AFLPLWALQFVIGIFAVLLAVGLFAALVGSVVRGPQTFFDEVGKTVSRIAPQPQADIRSDAELKAVIRALPDGRLRVASVVGEQDRVVFTVTADRAAVKAAAQAGDELRLSRTGDVEIAPTGIPGLVDRLQQAIEDLRRSWFGN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.