NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209337_1074804

Scaffold Ga0209337_1074804


Overview

Basic Information
Taxon OID3300025168 Open in IMG/M
Scaffold IDGa0209337_1074804 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-53 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1662
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)49.5666Long. (o)-138.6666Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004162Metagenome450Y
F017556Metagenome / Metatranscriptome240Y
F089527Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0209337_10748041F004162N/AMGKTQKVAILLGEKQKIEKEIEELQRSCQHSTKSIRNVRERLDSTTMVIRYVCDTCLLSIGYPNAKEIENFLNQ
Ga0209337_10748043F089527N/AMANMNKKFNPGQGKTPQQYEDSAKFAWYGVVGMVILLILFSLLSSCTTTKKCCDKEHVITEWDGDRQINWYSSTEEK
Ga0209337_10748044F017556N/AMKNQIKEPKFKEGQVASFPSAGTVGNRARKGGTITGVEKMYELKEENKNYYSNGICRGDLTTQYSLSNGEFKGYSYKCKTIQPGGFSAEIVMVEEFKLKLTTEEKVLNSYTIY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.