NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209824_10199725

Scaffold Ga0209824_10199725


Overview

Basic Information
Taxon OID3300025173 Open in IMG/M
Scaffold IDGa0209824_10199725 Open in IMG/M
Source Dataset NameWastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)706
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameNetherlands
CoordinatesLat. (o)52.2278Long. (o)5.919Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066535Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0209824_101997251F066535AGGAGMSLGYWETLISCQVDGAAVTAAAATSLLPAQAKKTIPANYFDVIGKKLIITATGRISSVVTTPGTARFDVRLGSIVVFDGLAILLDSVAAHTTVGWDLYIDLTCRAVGATANLFGYGRWTCEDILGVPATAPKGVLSAVLPWNATPAVGANFDSTVSAVVDLFFTQTVATGSCTVHQFNVYSPN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.