NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207882_1014364

Scaffold Ga0207882_1014364


Overview

Basic Information
Taxon OID3300025218 Open in IMG/M
Scaffold IDGa0207882_1014364 Open in IMG/M
Source Dataset NameMarine viral communities from the Deep Pacific Ocean - MSP-103 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1198
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)21.0597Long. (o)-150.4292Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003161Metagenome504N
F007893Metagenome / Metatranscriptome343Y

Sequences

Protein IDFamilyRBSSequence
Ga0207882_10143641F003161GAGGLSRSGALDRIDVLLSTITDPAFVAVIRAEPLALSGTPILAYWVQARTNGWQTLSDIGSTTTIMVRAYFRLQASADVRESIELELWDAMVEVDTKLRGDANLDGNCTDSTVGSATVATIDMGGALYRTATIPFDIQLYEEVTITP
Ga0207882_10143642F007893GGAGMAEPFGVHFEVTGPVFDGSGLRVMQGIINRGLEDMAILEGANKVKDQLYGPPASQYWQSSRSERHGAHTRDLKRRVGAALLRDNVAVFNAGGVNYAEKVEALYHMFENATNAINRDKAALYHKYIGGALIEAFD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.