NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208830_1010323

Scaffold Ga0208830_1010323


Overview

Basic Information
Taxon OID3300025238 Open in IMG/M
Scaffold IDGa0208830_1010323 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Atlantic Ocean - MP2634 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2424
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameNortheast of Antigua and Barbuda, North Atlantic Ocean
CoordinatesLat. (o)20.0Long. (o)-52.63Alt. (m)Depth (m)4002.69
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000615Metagenome / Metatranscriptome984Y
F007771Metagenome / Metatranscriptome345Y

Sequences

Protein IDFamilyRBSSequence
Ga0208830_10103235F000615GAGMCRLRTFYECSDGTMGFAEIVLSYDEDIAAHIRHWSTGGRIVISEHIDLV
Ga0208830_10103237F007771GAGGMETIIHAKNIDKKVRLALYGMLHHSATKLFPRRMKYVSIKLHLKHYVYDGVAMIEEDTKITNPRNFKIIIDPYRLEKDDWGRERNYSEWVSELLRTLAHEMVHVKQYIMGELTFKRGQMCWKKQKVDFKSEDDYYRSPHEVEAYGLEKWLQLGYTATWNKIEEKNG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.