NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208182_1028284

Scaffold Ga0208182_1028284


Overview

Basic Information
Taxon OID3300025251 Open in IMG/M
Scaffold IDGa0208182_1028284 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1305
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)43.29Long. (o)8.1Alt. (m)Depth (m)2535
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028038Metagenome / Metatranscriptome193Y
F085676Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0208182_10282842F028038AGGALANLDFFKREIENIQRQLIDKLDNLVVGLTKVSDTELMQLAKQIDFFQEMDRLGYSRLLQRVSDAYDNQIASIFSELSKRELGKVSAASIETLQQLRDFEMTYLTGQARQYADQLKNAMLRGIVTGQTNKQIMSGLARGFGVGTYISSSETSFLINDAFARFSNTSRAKAFEPFPQMKFQYIGVNDNKTRDVCQRALQEPPLTREEIDGLGYVDFGNRGGYNCRHDWVRAR
Ga0208182_10282843F085676N/ADLMDSLRSDIEQIYRPFEKEQFRIAQRICEVSGGIQLGDQFSIDFAEREVPMSQDEEIKYYDWAFKNNLETRQSYLRKHNPDLQEDEIQGIVEQIDQEQPQASETQSIIDRIGKQVG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.