Scaffold Ga0207895_1065033

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0207895_1065033

Scaffold Ga0207895_1065033

Overview

Basic Information
Taxon OID	3300025260 Open in IMG/M
Scaffold ID	Ga0207895_1065033 Open in IMG/M
Source Dataset Name	Marine viral communities from the Deep Pacific Ocean - MSP112 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	592
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM21-C338	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	15.9164	Long. (^o)	-124.5211	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075330	Metagenome	119	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0207895_10650331	F075330	N/A	QRWLRDKFLRQSGHYRGDVLNDPAIIASLIATISLVTLALANLIYRFGKLTAQVGHLRRDQTRRHDEYLQRSKERYDGLILRLARLETYFMTGSAGNDD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.